Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Hspa4 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB |
More info about Hspa4 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB15700 |
| Product name: | Hspa4 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant Hspa4. |
| Gene id: | 15525 |
| Gene name: | Hspa4 |
| Gene alias: | 70kDa|AI317151|APG-2|Hsp110|Hsp70RY|KIAA4025|mKIAA4025 |
| Gene description: | heat shock protein 4 |
| Immunogen: | Recombinant GST fusion protein corresponding to 92 mouse Hspa4. |
| Immunogen sequence/protein sequence: | LNLQNKQSLTVDPVVKTKEIEAKIKELTSICSPIISKPKPKVEPPKEEPKHAEQNGPVDGQGDNPGSQAAEHGADTAVPSDGDKKLPEMDID |
| Protein accession: | AK220167 |
| Form: | Liquid |
| Recommend dilutions: | Western Blot (1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS (50% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Mouse |
| Specificity: | Specific to recombinant protein GX0631. This antibody detects endogenous mHSPA4 protein in several cell types. It also recognizes human HSPA4 protein. |
| Reactivity: | Human |
| Applications: | WB |
| Shipping condition: | Dry Ice |
| Publications: | Cloning of apg-2 encoding a novel member of heat shock protein 110 family.Kaneko Y, Kimura T, Kishishita M, Noda Y, Fujita J. Gene. 1997 Apr 11;189(1):19-24. |