Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Kif21a polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Mouse |
| Host species | Rabbit |
| Applications | WB,IHC |
More info about Kif21a polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB15699 |
| Product name: | Kif21a polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant Kif21a. |
| Gene id: | 16564 |
| Gene name: | Kif21a |
| Gene alias: | AI850764|mKIAA1708 |
| Gene description: | kinesin family member 21A |
| Immunogen: | Recombinant GST fusion protein corresponding to 286 mouse Kif21a. |
| Immunogen sequence/protein sequence: | YQRKGFTGRVFTSKTARMKWQLLERRVTDIIMQKMTISNMEADMNRLLRQREELTKRREKLSKRREKIVKESGEGDKSVANIIEEMESLTANIDYINDSIADCQANIMQMEEAKEEGETLDVTAVINACTLTEARYLLDHFLSMGINKGLQAAQKEAQIKVLEGRLKQTEITSATQNQLLFHMLKEKAELNPELDALLGHALQDLDGAPPENEEDSSEEDGPLHSPGSEGSTLSSDLMKLCGEVKPKNKARRRTTTQMELLYADSSEVASDTSAGDASLSGPLAPV |
| Protein accession: | AK129426 |
| Form: | Liquid |
| Recommend dilutions: | Western Blot (1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS (50% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Mouse |
| Specificity: | Specific to recombinant protein GX0999. This antibody detects endogenous KIF21A protein in several cell types. |
| Reactivity: | Mouse |
| Applications: | WB,IHC |
| Shipping condition: | Dry Ice |
| Publications: | High-throughput production of recombinant antigens for mouse KIAA proteins in Escherichia coli: computational allocation of possible antigenic regions, and construction of expression plasmids of glutathione-S-transferase-fused antigens by an in vitro recombination-assisted method.Hara Y, Shimada K, Kohga H, Ohara O, Koga H. DNA Res. 2003 Jun 30;10(3):129-36. |