Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Ppfia3 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Mouse |
| Host species | Rabbit |
| Applications | WB |
More info about Ppfia3 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB15689 |
| Product name: | Ppfia3 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant Ppfia3. |
| Gene id: | 76787 |
| Gene name: | Ppfia3 |
| Gene alias: | 2410127E16Rik |
| Gene description: | protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 3 |
| Immunogen: | Recombinant GST fusion protein corresponding to 151 mouse Ppfia3. |
| Immunogen sequence/protein sequence: | DKTNHVSKEEAGVPRGEGPAVPGDTPPPTPRSARLERMAQALALQAGSPEDGAPPRGSESTPDSLHKAPKRKSIKSSIGRLFGKKEKGRMGPPGRESVSLAGTPSDETLATDPLGLAKLTGPGDKDRRNKRKHELLEEACRQGLPFAAWDG |
| Protein accession: | AB014554 (Human) |
| Form: | Liquid |
| Recommend dilutions: | Western Blot (1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS (50% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Mouse |
| Specificity: | Specific to recombinant protein GX1885. This antibody detects endogenous mPPFIA3 protein in several cell types. |
| Reactivity: | Mouse |
| Applications: | WB |
| Shipping condition: | Dry Ice |
| Publications: | High-throughput production of recombinant antigens for mouse KIAA proteins in Escherichia coli: computational allocation of possible antigenic regions, and construction of expression plasmids of glutathione-S-transferase-fused antigens by an in vitro recombination-assisted method.Hara Y, Shimada K, Kohga H, Ohara O, Koga H. DNA Res. 2003 Jun 30;10(3):129-36. |