Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Agrp polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Mouse,Sheep |
| Host species | Guinea Pig |
| Applications | IHC-Fr,IF |
More info about Agrp polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB14305 |
| Product name: | Agrp polyclonal antibody |
| Product description: | Guinea pig polyclonal antibody raised against synthetic peptide of Agrp. |
| Gene id: | 11604 |
| Gene name: | Agrp |
| Gene alias: | Agrt|Art |
| Gene description: | agouti related protein |
| Immunogen: | A synthetic peptide (conjugated with carrier protein) corresponding to amino acids 82-131 of mouse Agrp. |
| Immunogen sequence/protein sequence: | SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT |
| Protein accession: | P56473 |
| Form: | Lyophilized |
| Recommend dilutions: | Immunohistochemistry (1:2000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | Lyophilized from PBS |
| Storage instruction: | Store at 4°C on dry atmosphere. After reconstitution with deionized water, store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Product type: | Primary antibodies |
| Host species: | Guinea pig |
| Antigen species / target species: | Mouse |
| Reactivity: | Mouse,Sheep |
| Application image: |  |
| Application image note: | The cryostat section of the sheep hypothalamus was incubated in Agrp polyclonal antibody (Cat # PAB14305) at the dilution of 1 : 1000 overnight followed by incubation with biotinylated secondary antibodies. Cell bodies and nerve terminals in the sheep brain are intensely stained. This figure shows staining of cells when no pre-absorption is performed. |
| Applications: | IHC-Fr,IF |
| Shipping condition: | Dry Ice |
| Publications: | Prenatal development of hypothalamic neuropeptide systems in the nonhuman primate.Grayson BE, Allen SE, Billes SK, Williams SM, Smith MS, Grove KL. Neuroscience. 2006 Dec 28;143(4):975-86. Epub 2006 Oct 9. |