Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NOD1 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
More info about NOD1 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB13791 |
| Product name: | NOD1 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against synthetic peptide of NOD1. |
| Gene id: | 10392 |
| Gene name: | NOD1 |
| Gene alias: | CARD4|CLR7.1|NLRC1 |
| Gene description: | nucleotide-binding oligomerization domain containing 1 |
| Immunogen: | A synthetic peptide corresponding to amino acids 2-31 of human NOD1. |
| Immunogen sequence/protein sequence: | EEQGHSEMEIIPSESHPHIQLLKSNRELLV |
| Form: | Liquid |
| Recommend dilutions: | Western Blot (1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS (0.02% sodium azide) |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Specificity: | Recognizes Nod1. |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection of NOD1 (human) in HEK 293T transfected cells with NOD1 polyclonal antibody (Cat # PAB13791). 10 ug per lane of total cell extracts from mock transfected HEK 293T cells (lane 1) or HEK 293T cells transfected with a plasmid coding for human NOD1 (lane 2). |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |