Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of APOE (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | SDS-PAGE |
More info about APOE (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P4123 |
| Product name: | APOE (Human) Recombinant Protein |
| Product description: | Human APOE (NP_000032.1, 299 amino acids) partial recombinant protein expressed in Escherichia coli. |
| Gene id: | 348 |
| Gene name: | APOE |
| Gene alias: | AD2|LPG|MGC1571|apoprotein |
| Gene description: | apolipoprotein E |
| Genbank accession: | NM_000041 |
| Immunogen sequence/protein sequence: | MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH |
| Protein accession: | NP_000032.1 |
| Form: | Lyophilized |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | Lyophilized from 20mM sodium phosphate |
| Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with 5 mM sodium phosphate pH 7.8 containing 0.5 mM DTT, store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | SDS-PAGE |
| Shipping condition: | Dry Ice |