Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GLP-1 (7-37) K34R peptide
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | SDS-PAGE |
More info about GLP-1 (7-37) K34R peptide
| Brand: | Abnova |
| Reference: | P6193 |
| Product name: | GLP-1 (7-37) K34R peptide |
| Product description: | GLP-1 (7-37) (HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG) K34R mutant peptide with His tag expressed in Escherichia coli. |
| Gene id: | 2641 |
| Gene name: | GCG |
| Gene alias: | GLP1|GLP2|GRPP |
| Gene description: | glucagon |
| Form: | Lyophilized |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | Lyophilized from ddH2O with no additives |
| Storage instruction: | Store at -20°C. After reconstitution with ddH2O, store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | RP-HPLC, N-terminal sequencing, LC/MS/MS and SDS-PAGE |
| Tag: | His |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | SDS-PAGE |
| Shipping condition: | Dry Ice |