Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GZMA (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Reactivity | Human |
| Host species | Fungi |
| Applications | SDS-PAGE |
More info about GZMA (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P6169 |
| Product name: | GZMA (Human) Recombinant Protein |
| Product description: | Human GZMA (P12544) partial recombinant protein expressed in Pichia pastoris. |
| Gene id: | 3001 |
| Gene name: | GZMA |
| Gene alias: | CTLA3|HFSP |
| Gene description: | granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3) |
| Immunogen sequence/protein sequence: | EKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLMEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAV |
| Protein accession: | P12544 |
| Form: | Liquid |
| Preparation method: | Pichia pastoris expression system |
| Recommend dilutions: | SDS-PAGE The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS |
| Storage instruction: | Store at -20°C. For long term storage store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Fungi |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | SDS-PAGE |
| Shipping condition: | Dry Ice |