Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of IL6R (Human) Recombinant protein
| Brand | Abnova |
| Product type | Proteins |
| Reactivity | Human |
| Host species | Human |
| Applications | Func,SDS-PAGE |
More info about IL6R (Human) Recombinant protein
| Brand: | Abnova |
| Reference: | P6154 |
| Product name: | IL6R (Human) Recombinant protein |
| Product description: | Human IL6R (P08887) partial recombinant protein expressed in HEK293 cells. |
| Gene id: | 3570 |
| Gene name: | IL6R |
| Gene alias: | CD126|IL-6R-1|IL-6R-alpha|IL6RA|MGC104991 |
| Gene description: | interleukin 6 receptor |
| Immunogen sequence/protein sequence: | LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQD |
| Protein accession: | P08887 |
| Form: | Lyophilized |
| Preparation method: | Mammalian cell (HEK293) expression system |
| Recommend dilutions: | Activity assay SDS-PAGE The optimal working dilution should be determined by the end user. |
| Storage buffer: | Lyophilized from 1x PBS pH 7.2. |
| Storage instruction: | Store at -20°C. Reconstitute in 1x PBS, pH 7.2 to a concentration of 0.1-1.0 mg/mL. Do not vortex. This solution can be stored at 2-8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Human |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |