No products
Prices are tax excluded
Brand | Abnova |
Product type | Proteins |
Reactivity | Human |
Host species | Hamster |
Applications | Func,SDS-PAGE |
Brand: | Abnova |
Reference: | P6150 |
Product name: | FASLG (Human) Recombinant protein |
Product description: | Human FASLG (P48023) patial recombinant protein with His-tag expressed in CHO cells. |
Gene id: | 356 |
Gene name: | FASLG |
Gene alias: | APT1LG1|CD178|CD95L|FASL|TNFSF6 |
Gene description: | Fas ligand (TNF superfamily, member 6) |
Immunogen sequence/protein sequence: | HHHHHHHHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL |
Protein accession: | P48023 |
Form: | Lyophilized |
Preparation method: | Mammalian cell (CHO) expression system |
Recommend dilutions: | Activity assay SDS-PAGE The optimal working dilution should be determined by the end user. |
Storage buffer: | Lyophilized from 0.5x PBS, pH 7.5. |
Storage instruction: | Store at -20°C. Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C. |
Tag: | His |
Product type: | Proteins |
Host species: | Hamster |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | Func,SDS-PAGE |
Shipping condition: | Dry Ice |