No products
Prices are tax excluded
Brand | Abnova |
Product type | Proteins |
Reactivity | Human |
Host species | Insect |
Applications | Func,SDS-PAGE |
Brand: | Abnova |
Reference: | P6126 |
Product name: | TNFSF4 (Human) Recombinant protein |
Product description: | Human TNFSF4 (P23510) partial recombinant protein expressed in Hi-5 Insect cells. |
Gene id: | 7292 |
Gene name: | TNFSF4 |
Gene alias: | CD134L|CD252|GP34|OX-40L|OX4OL|TXGP1 |
Gene description: | tumor necrosis factor (ligand) superfamily, member 4 |
Immunogen sequence/protein sequence: | QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL |
Protein accession: | P23510 |
Form: | Lyophilized |
Preparation method: | Insect cell (Hi-5) expression system |
Recommend dilutions: | Activity assay SDS-PAGE The optimal working dilution should be determined by the end user. |
Storage buffer: | Lyophilized from 10 mM Tris pH 8.5. |
Storage instruction: | Store at -20°C. Reconstitute in water to a concentration of 0.5 mg/mL. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C. |
Tag: | None |
Product type: | Proteins |
Host species: | Insect |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | Func,SDS-PAGE |
Shipping condition: | Dry Ice |