Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MMP3 (Human) Recombinant protein
| Brand | Abnova |
| Product type | Proteins |
| Reactivity | Human |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
More info about MMP3 (Human) Recombinant protein
| Brand: | Abnova |
| Reference: | P6114 |
| Product name: | MMP3 (Human) Recombinant protein |
| Product description: | Human MMP3 (P08254) partial recombinant protein expressed in Escherichia coli. |
| Gene id: | 4314 |
| Gene name: | MMP3 |
| Gene alias: | CHDS6|MGC126102|MGC126103|MGC126104|MMP-3|SL-1|STMY|STMY1|STR1 |
| Gene description: | matrix metallopeptidase 3 (stromelysin 1, progelatinase) |
| Immunogen sequence/protein sequence: | MRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQFWAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEPGFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC |
| Protein accession: | P08254 |
| Form: | Lyophilized |
| Preparation method: | Escherichia coli expression system |
| Recommend dilutions: | Activity assay SDS-PAGE The optimal working dilution should be determined by the end user. |
| Storage buffer: | Lyophilized from 10 mM Sodium Phosphate( pH 7.5, 0.1% CHAPS and 0.1 mM Calcium Chloride). |
| Storage instruction: | Store at -20°C. Reconstitute in water to a concentration of 0.5-1.0 mg/mL. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C. |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |