Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GDF15 (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Reactivity | Human |
| Host species | Hamster |
| Applications | Func,SDS-PAGE |
More info about GDF15 (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P6078 |
| Product name: | GDF15 (Human) Recombinant Protein |
| Product description: | Human GDF15 (Q99988) partial recombinant protein expressed in CHO cell. |
| Gene id: | 9518 |
| Gene name: | GDF15 |
| Gene alias: | GDF-15|MIC-1|MIC1|NAG-1|PDF|PLAB|PTGFB |
| Gene description: | growth differentiation factor 15 |
| Immunogen sequence/protein sequence: | ARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI |
| Protein accession: | Q99988 |
| Form: | Lyophilized |
| Preparation method: | CHO cell expression system |
| Recommend dilutions: | SDS-PAGE Activity assay The optimal working dilution should be determined by the end user. |
| Storage buffer: | Lyophilized from 10mM Sodium Citrate, pH 3.0. |
| Storage instruction: | Store at -20°C. Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex. For extended storage, it is recommended to be further diluted in buffer containing carrier protein (e.g. 0.1% BSA) and stored in aliquots at -20°C to -80°C. |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Hamster |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |