Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Ccl27a (Mouse) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Reactivity | Mouse |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
More info about Ccl27a (Mouse) Recombinant Protein
| Brand: | Abnova |
| Reference: | P6076 |
| Product name: | Ccl27a (Mouse) Recombinant Protein |
| Product description: | Mouse Ccl27a (Q9Z1X0) full-length recombinant protein expressed in E. coli. |
| Gene id: | 20301 |
| Gene name: | Ccl27a |
| Gene alias: | ALP|AW558992|CTACK|CTAK|Ccl27|Ccl27b|ESkine|ILC|MGC130150|PESKY|Scya27|Scya27a|Scya27b|mILC |
| Gene description: | chemokine (C-C motif) ligand 27A |
| Immunogen sequence/protein sequence: | LPLPSSTSCCTQLYRQPLPSRLLRRIVHMELQEADGDCHLQAVVLHLARRSVCVHPQNRSLARWLERQGKRLQGTVPSLNLVLQKKMYSNPQQQN |
| Protein accession: | Q9Z1X0 |
| Form: | Lyophilized |
| Preparation method: | E. coli expression system |
| Recommend dilutions: | SDS-PAGE Activity assay The optimal working dilution should be determined by the end user. |
| Storage buffer: | Lyophilized from solutions contain no sodiun azide nor carrier protein. |
| Storage instruction: | Store at -20°C. Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex. For extended storage, it is recommended to be further diluted in buffer containing carrier protein (e.g. 0.1% BSA) and stored in aliquots at -20°C to -80°C. |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Mouse |
| Reactivity: | Mouse |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |