Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CCL18 (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Reactivity | Human,Mouse |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
More info about CCL18 (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P6071 |
| Product name: | CCL18 (Human) Recombinant Protein |
| Product description: | Human CCL18 (P55774) partial recombinant protein expressed in Escherichia coli. |
| Gene id: | 6362 |
| Gene name: | CCL18 |
| Gene alias: | AMAC-1|AMAC1|CKb7|DC-CK1|DCCK1|MIP-4|PARC|SCYA18 |
| Gene description: | chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) |
| Immunogen sequence/protein sequence: | AQVGTNKELCCLVYTSWQIPQKFLVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA |
| Protein accession: | P55774 |
| Form: | Lyophlized |
| Preparation method: | Escherichia coli expression system |
| Recommend dilutions: | Activity assay SDS-PAGE The optimal working dilution should be determined by the end user. |
| Storage buffer: | Lyophilized from 10 mM Sodium citrate, pH 4.0. |
| Storage instruction: | Store at -20°C. Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex. For extended storage, it is recommended to further dilute in buffer containing carrier protein (e.g. 0.1% BSA) and store in aliquots at -20°C to -80°C is recommended. |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |