CCL3 (Human) Recombinant Protein View larger

CCL3 (Human) Recombinant Protein

New product

259,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CCL3 (Human) Recombinant Protein

BrandAbnova
Product typeProteins
ReactivityBacteria,Bovine,Frog,Hamster,Human,Monkey,Mouse,Rat
Host speciesEscherichia coli
ApplicationsFunc,SDS-PAGE

More info about CCL3 (Human) Recombinant Protein

Brand: Abnova
Reference: P6068
Product name: CCL3 (Human) Recombinant Protein
Product description: Human CCL3 (P10147) partial recombinant protein expressed in Escherichia coli.
Gene id: 6348
Gene name: CCL3
Gene alias: G0S19-1|LD78ALPHA|MIP-1-alpha|MIP1A|SCYA3
Gene description: chemokine (C-C motif) ligand 3
Immunogen sequence/protein sequence: ASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Protein accession: P10147
Form: Lyophlized
Preparation method: Escherichia coli expression system
Recommend dilutions: Activity assay
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage buffer: Lyophilized from solutions contain no sodiun azide nor carrier protein.
Storage instruction: Store at -20°C.
Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
For extended storage, it is recommended to further dilute in buffer containing carrier protein (e.g. 0.1% BSA) and store in aliquots at -20°C to -80°C is recommended.
Tag: None
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Human
Reactivity: Bacteria,Bovine,Frog,Hamster,Human,Monkey,Mouse,Rat
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy CCL3 (Human) Recombinant Protein now

Add to cart