Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CCL3 (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Reactivity | Bacteria,Bovine,Frog,Hamster,Human,Monkey,Mouse,Rat |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
More info about CCL3 (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P6068 |
| Product name: | CCL3 (Human) Recombinant Protein |
| Product description: | Human CCL3 (P10147) partial recombinant protein expressed in Escherichia coli. |
| Gene id: | 6348 |
| Gene name: | CCL3 |
| Gene alias: | G0S19-1|LD78ALPHA|MIP-1-alpha|MIP1A|SCYA3 |
| Gene description: | chemokine (C-C motif) ligand 3 |
| Immunogen sequence/protein sequence: | ASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA |
| Protein accession: | P10147 |
| Form: | Lyophlized |
| Preparation method: | Escherichia coli expression system |
| Recommend dilutions: | Activity assay SDS-PAGE The optimal working dilution should be determined by the end user. |
| Storage buffer: | Lyophilized from solutions contain no sodiun azide nor carrier protein. |
| Storage instruction: | Store at -20°C. Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex. For extended storage, it is recommended to further dilute in buffer containing carrier protein (e.g. 0.1% BSA) and store in aliquots at -20°C to -80°C is recommended. |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Reactivity: | Bacteria,Bovine,Frog,Hamster,Human,Monkey,Mouse,Rat |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |