Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Csf1 (Rat) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Reactivity | Mouse,Rat |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
More info about Csf1 (Rat) Recombinant Protein
| Brand: | Abnova |
| Reference: | P6060 |
| Product name: | Csf1 (Rat) Recombinant Protein |
| Product description: | Rat Csf1 (homodimer) (Q8JZQ0) partial recombinant protein expressed in Escherichia coli. |
| Immunogen sequence/protein sequence: | MEVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSLAKCSSRDVVTKP |
| Protein accession: | Q8JZQ0 |
| Form: | Lyophlized |
| Preparation method: | Escherichia coli expression system |
| Recommend dilutions: | Activity assay SDS-PAGE The optimal working dilution should be determined by the end user. |
| Storage buffer: | Lyophilized from 20 mM Tris (pH 9.0, 0.1 mM Calcium Chloride and 100 mM Arginine). |
| Storage instruction: | Store at -20°C. Reconstitute in water to a concentration of 0.5-1.0 mg/mL. Do not vortex. For extended storage, it is recommended to further dilute in buffer containing carrier protein (e.g. 0.1% BSA) and store in aliquots at -20°C to -80°C is recommended. |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Rat |
| Reactivity: | Mouse,Rat |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |