Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of sspA (Staphylococcus aureus) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Reactivity | Staphylococcus |
| Origin species | Staphylococcus |
| Host species | Escherichia coli (E. coli) |
| Applications | Func,SDS-PAGE |
More info about sspA (Staphylococcus aureus) Recombinant Protein
| Reference: | P6015 |
| Product name: | sspA (Staphylococcus aureus) Recombinant Protein |
| Product description: | Staphylococcus aureus sspA (P0C1U8) partial recombinant protein expressed in Escherichia coli (E. coli). |
| Gene id: | 13875352 |
| Immunogen sequence/protein sequence: | LPNNDRHQITDTTNGHYAPVTYIQVEAPTGTFIASGVVVGKDTLLTNKHVVDATHGDPHALKAFPSAINQDNYPNGGFTAEQITKYSGEGDLAIVKFSPNEQNKHIGEVVKPATMSNNAETQVNQNITVTGYPGDKPVATMWESKGKITYLKGEAMQYDLSTTGGNSGSPVFNEKNEVIGIHWGGVPNEFNGAVFINENVRNFLKQNIEDIHFANDDQPNNPDNPDNPNNPDNPNNPDEPNNPDNPNNPDNPDNGDNNNSDNPDAA |
| Protein accession: | P0C1U8 |
| Form: | Lyophilized |
| Preparation method: | Escherichia coli (E. coli) expression system |
| Recommend dilutions: | Activity assay SDS-PAGE The optimal working dilution should be determined by the end user. |
| Storage buffer: | Lyophilized from solutions contain no sodiun azide nor carrier protein |
| Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Tag: | None |
| Shipping condition: | Dry Ice |