| Brand | Abnova |
| Product type | Proteins |
| Reactivity | Human |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
| Brand: | Abnova |
| Reference: | P6006 |
| Product name: | GDF11 (Human) Recombinant Protein |
| Product description: | Human GDF11 (O95390) partial recombinant protein expressed in Escherichia coli. |
| Gene id: | 10220 |
| Gene name: | GDF11 |
| Gene alias: | BMP-11|BMP11 |
| Gene description: | growth differentiation factor 11 |
| Immunogen sequence/protein sequence: | NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS |
| Protein accession: | O95390 |
| Form: | Lyophilized |
| Preparation method: | Escherichia coli expression system |
| Recommend dilutions: | Activity assay SDS-PAGE The optimal working dilution should be determined by the end user. |
| Storage buffer: | Lyophilized from solutions contain no sodiun azide nor carrier protein |
| Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |
| Publications: | GDF11 Rejuvenates Cerebrovascular Structure and Function in an Animal Model of Alzheimer's Disease.Zhang W, Guo Y, Li B, Zhang Q, Liu JH, Gu GJ, Wang JH, Bao RK, Chen YJ, Xu JR. J Alzheimers Dis. 2018;62(2):807-819. |