| Brand | Abnova |
| Product type | Proteins |
| Reactivity | Human |
| Host species | Human |
| Applications | Func,SDS-PAGE |
| Brand: | Abnova |
| Reference: | P5999 |
| Product name: | SFRP1 (Human) Recombinant Protein |
| Product description: | Human SFRP1 (Q8N474) partial recombinant protein expressed in HeLa cells. |
| Gene id: | 6422 |
| Gene name: | SFRP1 |
| Gene alias: | FRP|FRP-1|FRP1|FrzA|SARP2 |
| Gene description: | secreted frizzled-related protein 1 |
| Immunogen sequence/protein sequence: | SEYDYVSFQSDIGPYQSGRFYTKPPQCVDIPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPTFQSVFK |
| Protein accession: | Q8N474 |
| Form: | Lyophilized |
| Preparation method: | Mammalian cell (HeLa) expression system |
| Recommend dilutions: | Activity assay SDS-PAGE The optimal working dilution should be determined by the end user. |
| Storage buffer: | Lyophilized from solutions contain no sodiun azide nor carrier protein |
| Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Human |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |