| Brand | Abnova |
| Product type | Proteins |
| Reactivity | Human |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
| Brand: | Abnova |
| Reference: | P5985 |
| Product name: | IL28A (Human) Recombinant Protein |
| Product description: | Human IL28A (Q8IZJ0) partial recombinant protein expressed in Escherichia coli. |
| Gene id: | 282616 |
| Gene name: | IL28A |
| Gene alias: | IFNL2|IL-28A |
| Gene description: | interleukin 28A (interferon, lambda 2) |
| Immunogen sequence/protein sequence: | PVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV |
| Protein accession: | Q8IZJ0 |
| Form: | Lyophilized |
| Preparation method: | Escherichia coli expression system |
| Recommend dilutions: | Activity assay SDS-PAGE The optimal working dilution should be determined by the end user. |
| Storage buffer: | Lyophilized from solutions contain no sodiun azide nor carrier protein |
| Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |
| Publications: | IRF-1, RIG-I and MDA5 display potent antiviral activities against norovirus coordinately induced by different types of interferons.Dang W, Xu L, Yin Y, Chen S, Wang W, Hakim MS, Chang KO, Peppelenbosch MP, Pan Q. Antiviral Res. 2018 Jul;155:48-59. doi: 10.1016/j.antiviral.2018.05.004. Epub 2018 May 10. |