| Brand | Abnova |
| Product type | Proteins |
| Reactivity | Human,Mouse |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
| Brand: | Abnova |
| Reference: | P5983 |
| Product name: | FGF16 (Human) Recombinant Protein |
| Product description: | Human FGF16 (O43320) partial recombinant protein expressed in Escherichia coli. |
| Gene id: | 8823 |
| Gene name: | FGF16 |
| Gene alias: | - |
| Gene description: | fibroblast growth factor 16 |
| Immunogen sequence/protein sequence: | MAEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFHYR |
| Protein accession: | O43320 |
| Form: | Lyophilized |
| Preparation method: | Escherichia coli expression system |
| Recommend dilutions: | Activity assay SDS-PAGE The optimal working dilution should be determined by the end user. |
| Storage buffer: | Lyophilized from solutions contain no sodiun azide nor carrier protein |
| Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |