Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of AHSG (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Reactivity | Human |
| Host species | Human |
| Applications | Func,SDS-PAGE |
More info about AHSG (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P5981 |
| Product name: | AHSG (Human) Recombinant Protein |
| Product description: | Human AHSG (P02765) partial recombinant protein expressed in HEK293 cells. |
| Gene id: | 197 |
| Gene name: | AHSG |
| Gene alias: | A2HS|AHS|FETUA|HSGA |
| Gene description: | alpha-2-HS-glycoprotein |
| Immunogen sequence/protein sequence: | A-Chain: APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVL B-Chain: TVVQPSVGAAAGPVVPPCPGRIRHFKV |
| Protein accession: | P02765 |
| Form: | Lyophilized |
| Preparation method: | Mammalian cell (HEK293) expression system |
| Recommend dilutions: | Activity assay SDS-PAGE The optimal working dilution should be determined by the end user. |
| Storage buffer: | Lyophilized from solutions contain no sodiun azide nor carrier protein |
| Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Human |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |