Bmp4 (Mouse) Recombinant Protein View larger

Bmp4 (Mouse) Recombinant Protein

New product

259,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Bmp4 (Mouse) Recombinant Protein

BrandAbnova
Product typeProteins
ReactivityMouse
Host speciesEscherichia coli
ApplicationsFunc,SDS-PAGE

More info about Bmp4 (Mouse) Recombinant Protein

Brand: Abnova
Reference: P5958
Product name: Bmp4 (Mouse) Recombinant Protein
Product description: Mouse Bmp4 (P21275, 303 a.a. - 408 a.a.) partial recombinant protein expressed in Escherichia coli.
Gene id: 12159
Gene name: Bmp4
Gene alias: Bmp2b|Bmp2b-1|Bmp2b1
Gene description: bone morphogenetic protein 4
Immunogen sequence/protein sequence: KKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCRKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
Protein accession: P21275
Form: Lyophilized
Preparation method: Escherichia coli expression system
Recommend dilutions: Activity assay
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage buffer: Lyophilized from solutions contain no sodiun azide nor carrier protein
Storage instruction: Store at -20°C.
Reconstitute in 10 mM Citric Acid to a concentration of 0.1-1.0 mg/mL. Do not vortex.
Aliquot to avoid repeated freezing and thawing.
Tag: None
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Mouse
Reactivity: Mouse
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy Bmp4 (Mouse) Recombinant Protein now

Add to cart