Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Adipoq (Mouse) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Reactivity | Mouse |
| Host species | Insect |
| Applications | Func,SDS-PAGE |
More info about Adipoq (Mouse) Recombinant Protein
| Brand: | Abnova |
| Reference: | P5954 |
| Product name: | Adipoq (Mouse) Recombinant Protein |
| Product description: | Mouse Adipoq (Q60994, 21 a.a. - 247 a.a.) partial recombinant protein with His tag expressed in Hi-5 cells. |
| Gene id: | 11450 |
| Gene name: | Adipoq |
| Gene alias: | 30kDa|APN|Acdc|Acrp30|GBP28|adipo|apM1 |
| Gene description: | adiponectin, C1Q and collagen domain containing |
| Immunogen sequence/protein sequence: | RGHHHHHHHHVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN |
| Protein accession: | Q60994 |
| Form: | Lyophilized |
| Preparation method: | Insect cell (Hi-5) expression system |
| Recommend dilutions: | Activity assay SDS-PAGE The optimal working dilution should be determined by the end user. |
| Storage buffer: | Lyophilized from solutions contain no sodiun azide nor carrier protein |
| Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Tag: | His |
| Product type: | Proteins |
| Host species: | Insect |
| Antigen species / target species: | Mouse |
| Reactivity: | Mouse |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |