APOA1 (Human) Recombinant Protein View larger

APOA1 (Human) Recombinant Protein

New product

259,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of APOA1 (Human) Recombinant Protein

BrandAbnova
Product typeProteins
ReactivityHamster,Human
Host speciesEscherichia coli
ApplicationsSDS-PAGE

More info about APOA1 (Human) Recombinant Protein

Brand: Abnova
Reference: P5942
Product name: APOA1 (Human) Recombinant Protein
Product description: Human APOA1 (P02647) partial recombinant protein expressed in Escherichia coli.
Gene id: 335
Gene name: APOA1
Gene alias: MGC117399
Gene description: apolipoprotein A-I
Immunogen sequence/protein sequence: MDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
Protein accession: P02647
Form: Lyophilized
Preparation method: Escherichia coli expression system
Recommend dilutions: SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage buffer: Lyophilized from solutions contain no sodiun azide nor carrier protein
Storage instruction: Store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Tag: None
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Human
Reactivity: Hamster,Human
Applications: SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy APOA1 (Human) Recombinant Protein now

Add to cart