Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GH1 (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Reactivity | Human |
| Origin species | Human |
| Host species | Plants |
| Applications | WB-Re,Func,SDS-PAGE |
More info about GH1 (Human) Recombinant Protein
| Reference: | P5926 |
| Product name: | GH1 (Human) Recombinant Protein |
| Product description: | Human GH1 (205 a.a.) full-length recombinant protein with N-terminal His tag expressed in Nicotiana benthamiana. |
| Gene id: | 2688 |
| Gene name: | GH1 |
| Gene alias: | GH|GH-N|GHN|hGH-N |
| Gene description: | growth hormone 1 |
| Immunogen sequence/protein sequence: | HHHHHHFPTIPLSRPFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGFAG |
| Protein accession: | P01241 |
| Form: | Lyophilized |
| Preparation method: | Non-transgenic plants (Nicotiana benthamiana) expression system |
| Storage buffer: | Lyophilized from 10mM Phosphate Potasium buffer pH 7,6 and 0.05M NaCl |
| Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 15% SDS-polyacrylamide gel and stained with Coomassie blue |
| Note: | Result of activity analysis |
| Tag: | His |
| Shipping condition: | Dry Ice |