Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of IFNA2 (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Reactivity | Human |
| Origin species | Human |
| Host species | Plants |
| Applications | WB-Re,Func,SDS-PAGE |
More info about IFNA2 (Human) Recombinant Protein
| Reference: | P5916 |
| Product name: | IFNA2 (Human) Recombinant Protein |
| Product description: | Human IFNA2 (P01563, 171 a.a.) full-length recombinant protein with C-terminal His tag expressed in Nicotiana benthamiana. |
| Gene id: | 3440 |
| Gene name: | IFNA2 |
| Gene alias: | IFNA|INFA2|MGC125764|MGC125765 |
| Gene description: | interferon, alpha 2 |
| Immunogen sequence/protein sequence: | CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKEHHHHHH |
| Protein accession: | P01563 |
| Form: | Lyophilized |
| Preparation method: | Non-transgenic plants (Nicotiana benthamiana) expression system |
| Storage buffer: | Lyophilized from Tris HCl 0.05M buffer at pH 7.4 and 0.01% SDS |
| Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 0.3 ug/lane in 15% SDS-polyacrylamide gel and stained with Coomassie blue |
| Tag: | His |
| Shipping condition: | Dry Ice |