Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Oit1 (Mouse) Recombinant protein
| Brand | Abnova |
| Product type | Proteins |
| Reactivity | Mouse |
| Host species | Human |
| Applications | SDS-PAGE |
More info about Oit1 (Mouse) Recombinant protein
| Brand: | Abnova |
| Reference: | P5908 |
| Product name: | Oit1 (Mouse) Recombinant protein |
| Product description: | Mouse Oit1 (NP_666162, 26 a.a. - 223 a.a.) partial recombinant protein with C-terminal hexahistidine tag expressed in HEK293EBNA1 cells. |
| Gene id: | 18300 |
| Gene name: | Oit1 |
| Gene alias: | 2310076N21Rik|AV067083|EF-7|Fam3d|MGC37550 |
| Gene description: | oncoprotein induced transcript 1 |
| Genbank accession: | NM_146050 |
| Immunogen sequence/protein sequence: | GSYTSFSRKTIRLPRWLGITPKDIQTPKSKCGLSKICPNNAFKISSGAANVVGPSMCFEDEIIMSPVRNNVGRGLNVALVNGSTGQVMKKDSFDMYSGDPQLLLNTEIPDSTLVLVASYDDPGTKMNDKIKTLFSNLGSSYAKQLGFRDSWVFVGAKDLKSKSPYEQKNNPETNKYDGWPELLELEGCVPRKVMAAAHHHHHH |
| Protein accession: | NP_666162 |
| Form: | Liquid |
| Concentration: | 2.3 mg/mL |
| Preparation method: | Mammalian cell (HEK293EBNA1) expression system |
| Storage buffer: | In PBS without preservative |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | NuPAGE Stained with Coomassie Blue |
| Quality control testing picture: |  |
| Tag: | His |
| Product type: | Proteins |
| Host species: | Human |
| Antigen species / target species: | Mouse |
| Reactivity: | Mouse |
| Applications: | SDS-PAGE |
| Shipping condition: | Dry Ice |