Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of FAM3D (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Reactivity | Human |
| Host species | Human |
| Applications | SDS-PAGE |
More info about FAM3D (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P5907 |
| Product name: | FAM3D (Human) Recombinant Protein |
| Product description: | Human FAM3D (NP_620160, 26 a.a. - 224 a.a.) partial recombinant protein with C-terminal hexahistidine tag expressed in HEK293EBNA1 cells. |
| Gene id: | 131177 |
| Gene name: | FAM3D |
| Gene alias: | EF7|OIT1 |
| Gene description: | family with sequence similarity 3, member D |
| Genbank accession: | NM_138805 |
| Immunogen sequence/protein sequence: | GSYMSFSMKTIRLPRWLAASPTKEIQVKKYKCGLIKPCPANYFAFKICSGAANVVGPTMCFEDRMIMSPVKNNVGRGLNIALVNGTTGAVLGQKAFDMYSGDVMHLVKKEIPGGALVLVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVGAKDLRGKSPFEQKNSPDTNKYEGWPELLEMEGCMPPKPFAAAHHHHHH |
| Protein accession: | NP_666162 |
| Form: | Liquid |
| Preparation method: | Mammalian cell (HEK293EBNA1) expression system |
| Storage buffer: | In 25 mM Tris, 150 mM NaCl, pH 7.5 without preservative. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | NuPAGE Stained with Coomassie Blue |
| Quality control testing picture: |  |
| Tag: | His |
| Product type: | Proteins |
| Host species: | Human |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | SDS-PAGE |
| Shipping condition: | Dry Ice |