Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GH1 (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Reactivity | Human |
| Host species | Human |
| Applications | SDS-PAGE |
More info about GH1 (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P5906 |
| Product name: | GH1 (Human) Recombinant Protein |
| Product description: | Huamn GH1 (NP_000506, 1 a.a. - 217 a.a.) full-length recombinant protein with C-terminal hexahistidine tag expressed HEK293EBNA1 cells. |
| Gene id: | 2688 |
| Gene name: | GH1 |
| Gene alias: | GH|GH-N|GHN|hGH-N |
| Gene description: | growth hormone 1 |
| Genbank accession: | NM_000515 |
| Immunogen sequence/protein sequence: | FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGFGSAAAHHHHHH |
| Protein accession: | NP_00050 |
| Form: | Liquid |
| Preparation method: | Mammalian cell (HEK293EBNA1) expression system |
| Storage buffer: | In PBS without preservative |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Tag: | His |
| Product type: | Proteins |
| Host species: | Human |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | SDS-PAGE |
| Shipping condition: | Dry Ice |