Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of fshb/cga (Zebra fish) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Reactivity | Zebra fish |
| Host species | Human |
| Applications | SDS-PAGE |
More info about fshb/cga (Zebra fish) Recombinant Protein
| Brand: | Abnova |
| Reference: | P5905 |
| Product name: | fshb/cga (Zebra fish) Recombinant Protein |
| Product description: | Zebra fish fshb/cga (NP_991187, 17 a.a. - 130 a.a.) and (NP_991250, 24 a.a. - 117 a.a.) partial recombinant protein with N-terminal Strep tag expressed in HEK293EBNA1 cells. |
| Gene id: | 402919|402987 |
| Gene name: | fshb |
| Gene alias: | gthI |
| Gene description: | follicle stimulating hormone, beta polypeptide |
| Genbank accession: | NM_205624.1|NM_205687 |
| Immunogen sequence/protein sequence: | GSWSHPQFEKGSWSHPQFEKGSWSHPQFEKGSAESECRCSCRLTNISITVESEECGSCVTIDTTACAGLCWTMDRVYPSSMAQHTQKVCNFKNLMYKSYEFKGCPAGVDSVFVYPVALSCECNQVNSDTTDWGAISPQTTSCSIHGGGSGGGSGGGSGGGYSRNDVSNYGCEECKLKMNERFSKPGAPVYQCVGCCFSRAYPTPLRSKKTMLVPKNITSEATCCVAKESKMVATNIPLYNHTDCHCSTCYYHKS |
| Protein accession: | NP_991187 (Gene ID : 402919);NP_991250 (Gene ID : 402987) |
| Form: | Liquid |
| Concentration: | 0.98 mg/mL |
| Preparation method: | Mammalian cell (HEK293EBNA1) expression system |
| Storage buffer: | In PBS without preservative |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | NuPAGE Stained with Coomassie Blue |
| Quality control testing picture: |  |
| Tag: | Strep |
| Product type: | Proteins |
| Host species: | Human |
| Antigen species / target species: | Zebra fish |
| Reactivity: | Zebra fish |
| Applications: | SDS-PAGE |
| Shipping condition: | Dry Ice |