Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MBL2 (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Reactivity | Human |
| Host species | Human |
| Applications | SDS-PAGE |
More info about MBL2 (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P5889 |
| Product name: | MBL2 (Human) Recombinant Protein |
| Product description: | Human MBL2 (NP_000233, 21a.a. - 248 a.a.) partial recombinant protein with N-terminal hexahistidine tag and a TEV cleavage site expressed in HEK293EBNA1 cells. |
| Gene id: | 4153 |
| Gene name: | MBL2 |
| Gene alias: | COLEC1|HSMBPC|MBL|MBP|MBP1|MGC116832|MGC116833 |
| Gene description: | mannose-binding lectin (protein C) 2, soluble (opsonic defect) |
| Genbank accession: | NM_000242 |
| Immunogen sequence/protein sequence: | GSHHHHHHDYDIPSSENLYFQGSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPIAAA |
| Protein accession: | NP_000233 |
| Form: | Liquid |
| Concentration: | 175 ug/mL |
| Preparation method: | Mammalian cell (HEK293EBNA1) expression system |
| Storage buffer: | In PBS without preservative |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | NuPAGE Stained with Coomassie Blue |
| Quality control testing picture: |  |
| Quality control testing picture note: | Lane1: Non-reduced MBL2, Lane2: Reduced MBL2 |
| Tag: | His |
| Product type: | Proteins |
| Host species: | Human |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | SDS-PAGE |
| Shipping condition: | Dry Ice |