No products
Prices are tax excluded
Brand | Abnova |
Product type | Proteins |
Host species | Escherichia coli |
Applications | SDS-PAGE |
Brand: | Abnova |
Reference: | P5851 |
Product name: | CRYGN (Human) Recombinant Protein |
Product description: | Human CRYGN (NP_653328, 1 a.a. - 182 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli. |
Gene id: | 155051 |
Gene name: | CRYGN |
Gene alias: | MGC119042|MGC119043|MGC119044|MGC119045 |
Gene description: | crystallin, gamma N |
Immunogen sequence/protein sequence: | MGSSHHHHHHSSGLVPRGSHMGSHMAQRSGKITLYEGKHFTGQKLEVFGDCDNFQDRGFMNRVNSIHVESGAWVCFNHPDFRGQQFILEHGDYPDFFRWNSHSDHMGSCRPVGMHGEHFRLEIFEGCNFTGQCLEFLEDSPFLQSRGWVKNCVNTIKVYGDGAAWSPRSFGAEDFQLSSSLQSDQGPEEATTKPATTQPPFLTANL |
Form: | Liquid |
Preparation method: | Escherichia coli expression system |
Storage buffer: | In 20mM Tris-HCl buffer, pH 8.0 (0.4M Urea, 10% glycerol). |
Storage instruction: | Store at -20°C. For long term storage store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed. |
Quality control testing picture: | ![]() |
Tag: | His |
Product type: | Proteins |
Host species: | Escherichia coli |
Antigen species / target species: | Human |
Applications: | SDS-PAGE |
Shipping condition: | Dry Ice |