| Brand: | Abnova |
| Reference: | P5849 |
| Product name: | VTA1 (Human) Recombinant Protein |
| Product description: | Human VTA1 (NP_057569, 1 a.a. - 307 a.a. ) full-length recombinant protein with His tag expressed in Escherichia coli. |
| Gene id: | 51534 |
| Gene name: | VTA1 |
| Gene alias: | C6orf55|DRG-1|DRG1|FLJ27228|HSPC228|LIP5|My012|SBP1 |
| Gene description: | Vps20-associated 1 homolog (S. cerevisiae) |
| Immunogen sequence/protein sequence: | MGSSHHHHHHSSGLVPRGSHMGSHMAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETPQAGPVGIEEDNDIEENEDAGAASLPTQPTQPSSSSTYDPSNMPSGNYTGIQIPPGAHAPANTPAEVPHSTGVASNTIQPTPQTIPAIDPALFNTISQGDVRLTPEDFARAQKYCKYAGSALQYEDVSTAVQNLQKALKLLTTGRE |
| Form: | Liquid |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | In 20mM Tris-HCl buffer, pH 8.0 (2mM DTT, 10% glycerol, 200mM NaCl). |
| Storage instruction: | Store at -20°C. For long term storage store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed. |
| Quality control testing picture: |  |
| Tag: | His |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | SDS-PAGE |
| Shipping condition: | Dry Ice |