Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of AS3MT (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | SDS-PAGE |
More info about AS3MT (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P5400 |
| Product name: | AS3MT (Human) Recombinant Protein |
| Product description: | Human AS3MT (NP_065733, 1 a.a. - 375 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli. |
| Gene id: | 57412 |
| Gene name: | AS3MT |
| Gene alias: | CYT19 |
| Gene description: | arsenic (+3 oxidation state) methyltransferase |
| Immunogen sequence/protein sequence: | MGSSHHHHHHSSGLVPRGSHMGSHMAALRDAEIQKDVQTYYGQVLKRSADLQTNGCVTTARPVPKHIREALQNVHEEVALRYYGCGLVIPEHLENCWILDLGSGSGRDCYVLSQLVGEKGHVTGIDMTKGQVEVAEKYLDYHMEKYGFQASNVTFIHGYIEKLGEAGIKNESHDIVVSNCVINLVPDKQQVLQEAYRVLKHGGELYFSDVYTSLELPEEIRTHKVLWGECLGGALYWKELAVLAQKIGFCPPRLVTANLITIQNKELERVIGDCRFVSATFRLFKHSKTGPTKRCQVIYNGGITGHEKELMFDANFTFKEGEIVEVDEETAAILKNSRFAQDFLIRPIGEKLPTSGGCSALELKDIITDPFKLAEESDSMKSRCVPDAAGGCCGTKKSC |
| Protein accession: | NP_065733 |
| Form: | Liquid |
| Concentration: | 1 mg/mL |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | In 20 mM Tris-HCl, 0.15 M NaCl, pH 8.0 (10% glycerol) |
| Storage instruction: | Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Loading 3 ug protein in 15% SDS-PAGE |
| Quality control testing picture: |  |
| Tag: | His |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | SDS-PAGE |
| Shipping condition: | Dry Ice |
| Publications: | Interactive Effects of N6AMT1 and As3MT in Arsenic Biomethylation.Zhang H, Ge Y, He P, Chen X, Carina A, Qiu Y, Aga DS, Ren X. Toxicol Sci. 2015 May 20. pii: kfv101. [Epub ahead of print] |