No products
Prices are tax excluded
Brand | Abnova |
Product type | Proteins |
Host species | Escherichia coli |
Applications | SDS-PAGE |
Brand: | Abnova |
Reference: | P5397 |
Product name: | CD274 (Human) Recombinant Protein |
Product description: | Human CD274 (NP_054862, 19 a.a. - 238 a.a.) partial recombinant protein with His tag expressed in Escherichia coli. |
Gene id: | 29126 |
Gene name: | CD274 |
Gene alias: | B7-H|B7H1|MGC142294|MGC142296|PD-L1|PDCD1L1|PDCD1LG1|PDL1 |
Gene description: | CD274 molecule |
Immunogen sequence/protein sequence: | MGSSHHHHHHSSGLVPRGSHMGSHMFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER |
Protein accession: | NP_054862 |
Form: | Liquid |
Concentration: | 1 mg/mL |
Preparation method: | Escherichia coli expression system |
Storage buffer: | In 20 mM Tris-HCl, pH 8.0 (10% glycerol, 1 mM DTT) |
Storage instruction: | Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Loading 3 ug protein in 15% SDS-PAGE |
Quality control testing picture: | ![]() |
Tag: | His |
Product type: | Proteins |
Host species: | Escherichia coli |
Antigen species / target species: | Human |
Applications: | SDS-PAGE |
Shipping condition: | Dry Ice |