Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of IL12B (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Insect |
| Applications | SDS-PAGE |
More info about IL12B (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P5393 |
| Product name: | IL12B (Human) Recombinant Protein |
| Product description: | Human IL12B (NP_002178, 23 a.a. - 328 a.a.) partial recombinant protein with His tag expressed in Hi-5 cells. |
| Gene id: | 3593 |
| Gene name: | IL12B |
| Gene alias: | CLMF|CLMF2|IL-12B|NKSF|NKSF2 |
| Gene description: | interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40) |
| Immunogen sequence/protein sequence: | ADPIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCSHHHHHH |
| Protein accession: | NP_002178 |
| Form: | Liquid |
| Concentration: | 0.25 mg/mL |
| Preparation method: | Insect cell (Hi-5) expression system |
| Storage buffer: | In 20 mM Tris-HCl, 100mM NaCl, pH 8.0 (2 mM DTT, 20% glycerol, 0.1 mM PMSF) |
| Storage instruction: | Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Loading 3 ug protein in 15% SDS-PAGE |
| Quality control testing picture: |  |
| Tag: | His |
| Product type: | Proteins |
| Host species: | Insect |
| Antigen species / target species: | Human |
| Applications: | SDS-PAGE |
| Shipping condition: | Dry Ice |