Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of IL12B (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Origin species | Human |
| Host species | Plants |
| Applications | WB,Func,SDS-PAGE |
More info about IL12B (Human) Recombinant Protein
| Reference: | P5377 |
| Product name: | IL12B (Human) Recombinant Protein |
| Product description: | Human IL12B (P29460, 23 a.a. - 328 a.a.) partial recombinant protein with His tag expressed in Nicotiana benthamiana. |
| Gene id: | 3593 |
| Gene name: | IL12B |
| Gene alias: | CLMF|CLMF2|IL-12B|NKSF|NKSF2 |
| Gene description: | interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40) |
| Immunogen sequence/protein sequence: | HHHHHHIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS |
| Protein accession: | P29460 |
| Form: | Lyophilized |
| Preparation method: | Non-transgenic plants (Nicotiana benthamiana) expression system |
| Storage buffer: | Lyophilized from 20 mM PBS, pH 7.4 |
| Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with sterilized water containing 0.1% HSA or BSA to a concentration of 50 ng/ul, store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 0.3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue |
| Tag: | His |
| Shipping condition: | Dry Ice |