West Nile Virus Pre-M Recombinant Protein View larger

West Nile Virus Pre-M Recombinant Protein

New product

439,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of West Nile Virus Pre-M Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsSDS-PAGE

More info about West Nile Virus Pre-M Recombinant Protein

Brand: Abnova
Reference: P5123
Product name: West Nile Virus Pre-M Recombinant Protein
Product description: West Nile Virus Pre-M partial recombinant protein with His tag expressed in Escherichia coli.
Immunogen sequence/protein sequence: MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRAMDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESILRNPGYALE
Form: Liquid
Preparation method: Escherichia coli expression system
Storage buffer: In 20 mM phosphate buffer, pH 7.5
Storage instruction: Store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Tag: His
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Viruses
Applications: SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy West Nile Virus Pre-M Recombinant Protein now

Add to cart