Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of West Nile Virus Pre-M Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | SDS-PAGE |
More info about West Nile Virus Pre-M Recombinant Protein
| Brand: | Abnova |
| Reference: | P5123 |
| Product name: | West Nile Virus Pre-M Recombinant Protein |
| Product description: | West Nile Virus Pre-M partial recombinant protein with His tag expressed in Escherichia coli. |
| Immunogen sequence/protein sequence: | MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRAMDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESILRNPGYALE |
| Form: | Liquid |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | In 20 mM phosphate buffer, pH 7.5 |
| Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Tag: | His |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Viruses |
| Applications: | SDS-PAGE |
| Shipping condition: | Dry Ice |