tpx (Escherichia coli (E. coli)) Recombinant Protein View larger

tpx (Escherichia coli (E. coli)) Recombinant Protein

New product

279,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of tpx (Escherichia coli (E. coli)) Recombinant Protein

BrandAbnova
Product typeProteins
Origin speciesEscherichia coli (E. coli)
Host speciesEscherichia coli (E. coli)
ApplicationsSDS-PAGE

More info about tpx (Escherichia coli (E. coli)) Recombinant Protein

Reference: P5007
Product name: tpx (Escherichia coli (E. coli)) Recombinant Protein
Product description: Escherichia coli (E. coli) tpx (NP_415840, 1 a.a. - 168 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli (E. coli).
Gene id: 945880
Gene name: tpx
Gene alias: ECK1320|JW1317|yzzJ
Gene description: lipid hydroperoxide peroxidase
Immunogen sequence/protein sequence: MGSSHHHHHHSSGLVPRGSHMSQTVHFQGNPVTVANSIPQAGSKAQTFTLVAKDLSDVTLGQFAGKRKVLNIFPSIDTGVCAASVRKFNQLATEIDNTVVLCISADLPFAQSRFCGAEGLNNVITLSTFRNAEFLQAYGVAIADGPLKGLAARAVVVIDENDNVIFSQLVDEITTEPDYEAALAVLKA
Protein accession: NP_415840
Form: Liquid
Concentration: 1 mg/mL
Preparation method: Escherichia coli (E. coli) expression system
Storage buffer: In 20 mM Tris-HCl, 100 mM NaCl, pH 8.0 (1 mM DTT, 10% glycerol)
Storage instruction: Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Quality control testing: Loading 3 ug protein in 15% SDS-PAGE
Tag: His
Shipping condition: Dry Ice

Reviews

Buy tpx (Escherichia coli (E. coli)) Recombinant Protein now

Add to cart