No products
Prices are tax excluded
Brand | Abnova |
Product type | Proteins |
Origin species | S. japonicum |
Host species | Escherichia coli (E. coli) |
Applications | SDS-PAGE |
Reference: | P4988 |
Product name: | GST (Schistosoma japonicum) Recombinant Protein |
Product description: | Schistosoma japonicum GST (NP_ P08515, 1 a.a. - 224 a.a.) full-length recombinant protein expressed in Escherichia coli (E. coli). |
Immunogen sequence/protein sequence: | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPR |
Protein accession: | NP_ P08515 |
Form: | Liquid |
Concentration: | 1 mg/mL |
Preparation method: | Escherichia coli (E. coli) expression system |
Storage buffer: | In PBS, pH 7.4 |
Storage instruction: | Store at 4°C. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Loading 3 ug protein in 15% SDS-PAGE |
Tag: | None |
Shipping condition: | Dry Ice |