Reference: | P4982 |
Product name: | skp (Escherichia coli (E. coli)) Recombinant protein |
Product description: | Escherichia coli (E. coli) skp (NP_414720, 21 a.a. - 161 a.a.) partial recombinant protein with His tag expressed in Escherichia coli (E. coli). |
Gene id: | 944861 |
Gene name: | skp |
Gene alias: | ECK0177|JW0173|hlpA|ompH |
Gene description: | periplasmic chaperone |
Immunogen sequence/protein sequence: | MGSSHHHHHHSSGLVPRGSHMADKIAIVNMGSLFQQVAQKTGVSNTLENEFKGRASELQRMETDLQAKMKKLQSMKAGSDRTKLEKDVMAQRQTFAQKAQAFEQDRARRSNEERGKLVTRIQTAVKSVANSQDIDLVVDANAVAYNSSDVKDITADVLKQVK |
Protein accession: | NP_414720 |
Form: | Liquid |
Concentration: | 1 mg/mL |
Preparation method: | Escherichia coli (E. coli) expression system |
Storage buffer: | In 20 mM Tris-HCl, pH 8.0 (20% glycerol) |
Storage instruction: | Store at -20°C. For long term storage store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 15% SDS-PAGE Stained with Coomassie Blue |
Tag: | His |
Shipping condition: | Dry Ice |