Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of fur (Escherichia coli (E. coli)) Recombinant protein
| Brand | Abnova |
| Product type | Proteins |
| Origin species | Escherichia coli (E. coli) |
| Host species | Escherichia coli (E. coli) |
| Applications | SDS-PAGE |
More info about fur (Escherichia coli (E. coli)) Recombinant protein
| Reference: | P4972 |
| Product name: | fur (Escherichia coli (E. coli)) Recombinant protein |
| Product description: | Escherichia coli (E. coli) fur (NP_415209, 1 a.a. - 148 a.a.) full-length recombinant protein expressed in Escherichia coli (E. coli). |
| Gene id: | 945295 |
| Gene name: | fur |
| Gene alias: | ECK0671|JW0669 |
| Gene description: | DNA-binding transcriptional dual regulator of siderophore biosynthesis and transport |
| Immunogen sequence/protein sequence: | MTDNNTALKKAGLKVTLPRLKILEVLQEPDNHHVSAEDLYKRLIDMGEEIGLATVYRVLNQFDDAGIVTRHNFEGGKSVFELTQQHHHDHLICLDCGKVIEFSDDSIEARQREIAAKHGIRLTNHSLYLYGHCAEGDCREDEHAHEGK |
| Protein accession: | NP_415209 |
| Form: | Liquid |
| Concentration: | 1 mg/mL |
| Preparation method: | Escherichia coli (E. coli) expression system |
| Storage buffer: | In 20 mM Tris, 2 mM CaCl², 100mM NaCl, pH 8.0 |
| Storage instruction: | Store at -20°C. For long term storage store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 15% SDS-PAGE Stained with Coomassie Blue |
| Tag: | None |
| Shipping condition: | Dry Ice |