Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CD274 (Human) Recombinanat Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Hamster |
| Applications | SDS-PAGE |
More info about CD274 (Human) Recombinanat Protein
| Brand: | Abnova |
| Reference: | P4938 |
| Product name: | CD274 (Human) Recombinanat Protein |
| Product description: | Human CD274 recombinanat protein fused to murine IgG2a Fc and hinge region purifird from CHO cells. |
| Gene id: | 29126 |
| Gene name: | CD274 |
| Gene alias: | B7-H|B7H1|MGC142294|MGC142296|PD-L1|PDCD1L1|PDCD1LG1|PDL1 |
| Gene description: | CD274 molecule |
| Immunogen sequence/protein sequence: | CD274 mature: ftvtvpkdlyvveygsnmtieckfpvekqldlaalivywemedkniiqfvhgeedlkvqhssyrqrarllkdqlslgnaalqitdvklqdagvyrcmisyggadykritvkvnapynkinqrilvvdpvtseheltcqaegypkaeviwtssdhqvlsgkttttnskreeklfnvtstlrintttneifyctfrrldpeenhtaelvipelplahppnerthtr Linker +Murine IgG2a Hinge + Fc: gteprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpg |
| Form: | Liquid |
| Concentration: | 0.5 mg/mL |
| Preparation method: | Mammalian cell (CHO) expression system |
| Storage buffer: | In 50 mM sodium phosphate, 100 mM potassium chloride, 150 mM NaCl, pH 7.5. (0.5 mg/mL gentamicin sulfate) |
| Storage instruction: | Store at 4°C. This product is stable for at least 3 months. |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Hamster |
| Antigen species / target species: | Human |
| Applications: | SDS-PAGE |
| Shipping condition: | Blue Ice |