Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ADAMTS1 (d618-968) (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Insect |
| Applications | Func,SDS-PAGE |
More info about ADAMTS1 (d618-968) (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P4930 |
| Product name: | ADAMTS1 (d618-968) (Human) Recombinant Protein |
| Product description: | Human ADAMTS1 (253 a.a. - 617 a.a.) amino acids 618-968 deleted partial recombinant protein with His tag expressed in insect cells. |
| Gene id: | 9510 |
| Gene name: | ADAMTS1 |
| Gene alias: | C3-C5|KIAA1346|METH1 |
| Gene description: | ADAM metallopeptidase with thrombospondin type 1 motif, 1 |
| Immunogen sequence/protein sequence: | FVSSHRYVETMLVADQSMAEFHGSGLKHYLLTLFSVAARLYKHPSIRNSVSLVVVKILVIHDEQKGPEVTSNAALTLRNFCNWQKQHNPPSDRDAEHYDTAILFTRQDLCGSQTCDTLGMADVGTVCDPSRSCSVIEDDGLQAAFTTAHELGHVFNMPHDDAKQCASLNGVNQDSHMMASMLSNLDHSQPWSPCSAYMITSFLDNGHGECLMDKPHNPIQLPGDLPGTSYDANRQCQFTFGEDSKHCPDAASTCSTLWCTGTSGGVLVCQTKHFPWADGTSCGEGKWCINGKCVNKTDRKHFDTPFHGNWGMWGPWGDCSRTCGGGVQYTMRECDNPVPKNGGKYCEGKRVRYRSCNLEDCPDN |
| Protein accession: | Q9UHI8 |
| Form: | Liquid |
| Concentration: | 0.2 mg/mL |
| Preparation method: | Insect cell expression system |
| Storage buffer: | In 50 mM Tris-HCl, 150 mM NaCl, 5 mM CaCl2, pH 7.5 (0.05 % Brij-35 detergent) |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 15% SDS-PAGE Stained with Coomassie Blue |
| Quality control testing picture: |  |
| Tag: | His |
| Product type: | Proteins |
| Host species: | Insect |
| Antigen species / target species: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |