Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MMP16 (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
More info about MMP16 (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P4927 |
| Product name: | MMP16 (Human) Recombinant Protein |
| Product description: | Human MMP16 (91 a.a. - 279 a.a.) partial recombinant protein expressed in Escherichia coli. |
| Gene id: | 4325 |
| Gene name: | MMP16 |
| Gene alias: | C8orf57|MMP-X2|MT-MMP2|MT-MMP3|MT3-MMP |
| Gene description: | matrix metallopeptidase 16 (membrane-inserted) |
| Immunogen sequence/protein sequence: | LTGRKWQHKHITYSIKNVTPKVGDPETRKAIRRAFDVWQNVTPLTFEEVPYSELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPTRPLPTVPPHR |
| Protein accession: | P51512 |
| Form: | Liquid |
| Concentration: | 0.2 mg/mL |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | In 50 mM Tris-HCl, 150 mM NaCl, 5 mM CaCl2, pH 7.5 (1 % glycerin, 0.1% Triton X-100) |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 15% SDS-PAGE Stained with Coomassie Blue |
| Quality control testing picture: |  |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |