HBsAg (preS1) Recombinant Protein View larger

HBsAg (preS1) Recombinant Protein

New product

439,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HBsAg (preS1) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsSDS-PAGE

More info about HBsAg (preS1) Recombinant Protein

Brand: Abnova
Reference: P4876
Product name: HBsAg (preS1) Recombinant Protein
Product description: HBsAg preS1(AAK51534, 119 amino acids) recombinanat protein expressed in Escherichia coli.
Immunogen sequence/protein sequence: MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQA
Protein accession: AAK51534
Form: Liquid
Preparation method: Escherichia coli expression system
Storage buffer: In 20 mM PB, 50 mM NaCl, pH 7.4
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Tag: None
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Viruses
Applications: SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy HBsAg (preS1) Recombinant Protein now

Add to cart