Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CXCL12 (Beta) (Cat) Recombinant protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
More info about CXCL12 (Beta) (Cat) Recombinant protein
| Brand: | Abnova |
| Reference: | P4854 |
| Product name: | CXCL12 (Beta) (Cat) Recombinant protein |
| Product description: | Feline CXCL12 (beta) recombinant protein expressed in Escherichia coli. |
| Gene id: | 493806 |
| Gene name: | CXCL12 |
| Gene alias: | SDF-1 |
| Gene description: | chemokine (C-X-C motif) ligand 12 |
| Immunogen sequence/protein sequence: | KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM |
| Protein accession: | O62657-2 |
| Form: | Lyophilized |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Cat |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |