Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Ccl19 (Mouse) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
More info about Ccl19 (Mouse) Recombinant Protein
| Brand: | Abnova |
| Reference: | P4614 |
| Product name: | Ccl19 (Mouse) Recombinant Protein |
| Product description: | Mouse Ccl19 (Q548P0) recombinant protein expressed in Escherichia coli. |
| Gene id: | 24047 |
| Gene name: | Ccl19 |
| Gene alias: | CKb11|ELC|MIP3B|Scya19|exodus-3 |
| Gene description: | chemokine (C-C motif) ligand 19 |
| Immunogen sequence/protein sequence: | GANDAEDCCLSVTQRPIPGNIVKAFRYLLNEDGCRVPAVVFTTLRGYQLCAPPDQPWVDRIIRRLKKSSAKNKGNSTRRSPVS |
| Protein accession: | Q548P0 |
| Form: | Lyophilized |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Mouse |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |